PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_4BL_7911992DE.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family Dof
Protein Properties Length: 211aa    MW: 21956.6 Da    PI: 10.5561
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_4BL_7911992DE.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1245e-3980140262
                 zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                            +e alkcprCdstntkfCyynnyslsqPr+fCkaCrryWt+GGalr vPvGgg+r+nk+ss
  Traes_4BL_7911992DE.1  80 PEPALKCPRCDSTNTKFCYYNNYSLSQPRHFCKACRRYWTRGGALRSVPVGGGCRRNKRSS 140
                            67899*****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-3764136IPR003851Zinc finger, Dof-type
PfamPF027013.3E-3383138IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.55384138IPR003851Zinc finger, Dof-type
PROSITE patternPS01361086122IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009640Biological Processphotomorphogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 211 aa     Download sequence    Send to blast
MVFPPATAYL DPPNWNNQQQ RATGGGGVGD AQHMPEGPTA GTPEVGGLPR SSAANEAAAG  60
QQARPNSMTE RARMARVPQP EPALKCPRCD STNTKFCYYN NYSLSQPRHF CKACRRYWTR  120
GGALRSVPVG GGCRRNKRSS KSSAGAVSSS KPSSSSARQL PGVASSMPST AASTTLGADG  180
ASIPPGLSSM SHHLPFMGAM HPPGANLGLA F
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00407DAPTransfer from AT3G55370Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3758440.0AK375844.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3107J22.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015629100.15e-84PREDICTED: dof zinc finger protein DOF3.6-like isoform X1
SwissprotQ9M2U12e-46DOF36_ARATH; Dof zinc finger protein DOF3.6
TrEMBLW5E4P81e-153W5E4P8_WHEAT; Uncharacterized protein
STRINGMLOC_57297.31e-122(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP123012432
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02460.13e-43Dof family protein
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]